PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G02045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 256aa    MW: 28582.4 Da    PI: 8.6907
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G02045.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81.1e-31958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+i+fss+gklye+ 
  Pahal.G02045.1  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIVFSSRGKLYEFG 58
                    79**********************************************95 PP

2K-box103.52.7e-34861721399
           K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                     + +s++qe+++Lk+++e+Lqr+qRh+lGedL++Ls+keLqqLe+qLe +l++ R++K+++++eq++el++ke++l e nk+L++kle
  Pahal.G02045.1  86 EPQSWYQEMSRLKAKLESLQRSQRHMLGEDLGPLSIKELQQLEKQLEYALSQARQRKTQMMMEQVDELRRKERQLGELNKQLKNKLE 172
                     679**********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.529161IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.47E-46277No hitNo description
SuperFamilySSF554554.58E-33275IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129717.61987177IPR002487Transcription factor, K-box
PfamPF014868.4E-3187171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIVFSS RGKLYEFGSA  60
GVNKTLEKYH NCCYNAQGSN NDFGGEPQSW YQEMSRLKAK LESLQRSQRH MLGEDLGPLS  120
IKELQQLEKQ LEYALSQARQ RKTQMMMEQV DELRRKERQL GELNKQLKNK LEAEGCSNYR  180
AVVQTSWAPD AAVGSDGGAL PAPNAQPPVA AMDCEPTLQI GYHQFVAPDQ AAAMPRSSTT  240
EGGEQNGHFM LGWAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-21269168Myocyte-specific enhancer factor 2A
3kov_B1e-21269168Myocyte-specific enhancer factor 2A
3kov_I1e-21269168Myocyte-specific enhancer factor 2A
3kov_J1e-21269168Myocyte-specific enhancer factor 2A
3p57_A1e-21269168Myocyte-specific enhancer factor 2A
3p57_B1e-21269168Myocyte-specific enhancer factor 2A
3p57_C1e-21269168Myocyte-specific enhancer factor 2A
3p57_D1e-21269168Myocyte-specific enhancer factor 2A
3p57_I1e-21269168Myocyte-specific enhancer factor 2A
3p57_J1e-21269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976585.11e-174PREDICTED: MADS-box transcription factor 17-like isoform X2
SwissprotQ7XUN21e-133MAD17_ORYSJ; MADS-box transcription factor 17
TrEMBLK3Y9K61e-174K3Y9K6_SETIT; Uncharacterized protein
STRINGSi010898m1e-174(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41873566
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-94AGAMOUS-like 6